PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5928764 to PF07869 (DUF1656)

VIMSS5928764 has 70 amino acids

Query:       DUF1656  [M=56]
Accession:   PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      9e-27   79.2   7.2    1.1e-26   79.0   7.2    1.1  1  VIMSS5928764  


Domain annotation for each sequence (and alignments):
>> VIMSS5928764  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.0   7.2   1.1e-26   1.1e-26       1      56 []       4      59 ..       4      59 .. 0.98

  Alignments for each domain:
  == domain 1  score: 79.0 bits;  conditional E-value: 1.1e-26
       DUF1656  1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
                  Eid++Gv+vp+ lvl+l+A+++ +++r++l r+g+yrlvWh+++fdl+++v++l++
  VIMSS5928764  4 EIDIFGVFVPAPLVLMLIAYLINIVVRAVLERVGFYRLVWHRSIFDLGIYVFVLAA 59
                  9****************************************************985 PP



Or compare VIMSS5928764 to CDD or PaperBLAST