VIMSS5932362 has 106 amino acids
Query: DUF732 [M=72] Accession: PF05305.18 Description: Protein of unknown function (DUF732) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-23 69.0 0.4 2.6e-23 68.6 0.4 1.1 1 VIMSS5932362 Domain annotation for each sequence (and alignments): >> VIMSS5932362 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.6 0.4 2.6e-23 2.6e-23 1 71 [. 30 100 .. 30 101 .. 0.97 Alignments for each domain: == domain 1 score: 68.6 bits; conditional E-value: 2.6e-23 DUF732 1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCP 71 +D +FlaaL++aG+ty++pd+ai+ +++vC Ld G+s ++++++ ++npg+ + a++f+ +A+++yCP VIMSS5932362 30 DDVGFLAALQNAGITYSNPDQAIGSAKAVCWCLDGGESGLELVHDVKTHNPGFNMEAASQFAVLAATYYCP 100 6889*******************************************************9999******** PP
Or compare VIMSS5932362 to CDD or PaperBLAST