PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5932362 to PF05305 (DUF732)

VIMSS5932362 has 106 amino acids

Query:       DUF732  [M=72]
Accession:   PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.9e-23   69.0   0.4    2.6e-23   68.6   0.4    1.1  1  VIMSS5932362  


Domain annotation for each sequence (and alignments):
>> VIMSS5932362  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   68.6   0.4   2.6e-23   2.6e-23       1      71 [.      30     100 ..      30     101 .. 0.97

  Alignments for each domain:
  == domain 1  score: 68.6 bits;  conditional E-value: 2.6e-23
        DUF732   1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCP 71 
                   +D +FlaaL++aG+ty++pd+ai+ +++vC  Ld G+s  ++++++ ++npg+  + a++f+ +A+++yCP
  VIMSS5932362  30 DDVGFLAALQNAGITYSNPDQAIGSAKAVCWCLDGGESGLELVHDVKTHNPGFNMEAASQFAVLAATYYCP 100
                   6889*******************************************************9999******** PP



Or compare VIMSS5932362 to CDD or PaperBLAST