VIMSS59743 has 271 amino acids
Query: DUF4123 [M=123] Accession: PF13503.10 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-24 71.9 2.3 2.8e-24 71.9 2.3 2.3 2 VIMSS59743 Domain annotation for each sequence (and alignments): >> VIMSS59743 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.9 2.3 2.8e-24 2.8e-24 4 121 .. 28 148 .. 27 150 .. 0.84 2 ? -0.7 0.1 0.087 0.087 8 37 .. 234 263 .. 215 267 .. 0.70 Alignments for each domain: == domain 1 score: 71.9 bits; conditional E-value: 2.8e-24 DUF4123 4 LlDg...aadpellelleaesgeaaseLyagtpeeelaevgPwLveledaselsallrleeegwgpslglllaSaapleelarhLrsllqvrlp.dgea 98 L+D+ +p l e++++++++a +L+++tpe++la+ gP+L++led++++ +l +l+e ++ +ll S++pl++l +hLrs++q++++ + ++ VIMSS59743 28 LVDAtglDDYPLLAEHARQSDPPALFKLLEQTPEAALADEGPLLLRLEDGHAA-WLDELLERIDCRRHLMLLFSPWPLPRLGEHLRSCTQAEWNqGRSS 125 788877667788888899999988888***********************554.33335666666666678**********************835678 PP DUF4123 99 vllRfydprvlrallptldeeqr 121 +lRfy+p ++a+ ++ld++q VIMSS59743 126 GVLRFYEPGLFMAVSDMLDPRQS 148 9*******************996 PP == domain 2 score: -0.7 bits; conditional E-value: 0.087 DUF4123 8 aadpellelleaesgeaaseLyagtpeeel 37 aad++ l+ + + ++ a++L ++tp++ + VIMSS59743 234 AADRQGLQDFDQRDAFVAQWLREQTPGPGF 263 566677777777777777777777777665 PP
Or compare VIMSS59743 to CDD or PaperBLAST