VIMSS59903 has 221 amino acids
Query: DUF480 [M=149] Accession: PF04337.16 Description: Protein of unknown function, DUF480 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-60 188.4 0.7 6.9e-60 187.6 0.2 1.6 3 VIMSS59903 Domain annotation for each sequence (and alignments): >> VIMSS59903 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 187.6 0.2 6.9e-60 6.9e-60 1 149 [] 14 158 .. 14 158 .. 0.99 2 ? 2.0 0.0 0.011 0.011 65 91 .. 151 177 .. 146 182 .. 0.80 3 ? -3.0 0.0 0.38 0.38 129 141 .. 200 212 .. 184 219 .. 0.51 Alignments for each domain: == domain 1 score: 187.6 bits; conditional E-value: 6.9e-60 DUF480 1 lsaveaRvlgvLiEKelttPdaYPLslnalvaacNqkssRdPvmeleesevqealdeLkkkklvseaseagsRvakyehrlaealklseaelavlalll 99 lsav+aR+lg+L+EK++ttP++YPL+lnalv+acNqk+sRdPvm+l+ +v ++l++L+ ++lv+ + +gsR++++eh+l + l+l + ++a+l+ll+ VIMSS59903 14 LSAVDARILGSLVEKQATTPETYPLTLNALVLACNQKTSRDPVMNLTPGQVGQSLRQLEGRGLVRLV--MGSRADRWEHTLGKGLELVAPQVALLGLLF 110 7899***************************************************************..****************************** PP DUF480 100 LRGpqtagelrtraeRlaefadveeveevLeelaereeplvvklprepGk 149 LRGpqt +el tr++Rl++f+dve+++++Le+la r l+v+l+r++G+ VIMSS59903 111 LRGPQTLNELLTRSNRLHDFDDVEQIRHHLERLAGR--GLAVHLERRAGQ 158 ***********************************9..9*********96 PP == domain 2 score: 2.0 bits; conditional E-value: 0.011 DUF480 65 seaseagsRvakyehrlaealklseae 91 + +++ag+R ++y h l ++ +l++a VIMSS59903 151 HLERRAGQREERYMHLLGSQADLEAAV 177 4556899**********9999998765 PP == domain 3 score: -3.0 bits; conditional E-value: 0.38 DUF480 129 Leelaereeplvv 141 ++el +r ++l VIMSS59903 200 IAELETRLAALEE 212 3333333333333 PP
Or compare VIMSS59903 to CDD or PaperBLAST