VIMSS60161 has 231 amino acids
Query: DUF533 [M=178] Accession: PF04391.16 Description: Protein of unknown function (DUF533) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-74 233.4 6.7 1e-73 232.9 6.7 1.2 1 VIMSS60161 Domain annotation for each sequence (and alignments): >> VIMSS60161 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 232.9 6.7 1e-73 1e-73 2 178 .] 41 223 .. 40 223 .. 0.97 Alignments for each domain: == domain 1 score: 232.9 bits; conditional E-value: 1e-73 DUF533 2 lgggaaaggllglllGgkkarklggkalklGglAalgglAykayqnwqanqseaaqeeaaq.....e.eeeeekaelllrAmiaAAkADGhideeErar 94 +ggga+a+g++glllG+kkark+ggka+++GglAalg++Aykay+nwq++q+ aa+++++q + +++e +++++l+A++ AAkADGhide+Er++ VIMSS60161 41 AGGGALAAGAIGLLLGNKKARKFGGKAITYGGLAALGVIAYKAYNNWQQQQNGAAPQAQPQtvdrlPeAQAEVHSHAILQAIVGAAKADGHIDERERQM 139 689*************************************************99999999999998547****************************** PP DUF533 95 IvqeleelgldaeeqalleaeLakPldlaelaaavktpelaaevYlaSllaidedsaaEraYLdeLaeaLkLdpelvaeleqqv 178 I++e+++l+ d+e+q +le+eL+kPld+ae+a+a++tpe aae+YlaSll++de+s++Er+YL+eLa++L+L+p+++ ele+q+ VIMSS60161 140 IEGEVAKLTSDREVQGWLERELNKPLDPAEIARAASTPEIAAEMYLASLLMVDEESFMERSYLEELARQLRLEPSFKLELENQA 223 *********************************************************************************996 PP
Or compare VIMSS60161 to CDD or PaperBLAST