VIMSS60201 has 64 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-23 67.6 3.8 4e-23 67.4 3.8 1.1 1 VIMSS60201
Domain annotation for each sequence (and alignments):
>> VIMSS60201
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.4 3.8 4e-23 4e-23 1 47 [. 8 53 .. 8 54 .. 0.97
Alignments for each domain:
== domain 1 score: 67.4 bits; conditional E-value: 4e-23
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
sPC++vC ld e+++C+GC+Rt +Ei++W ms++err+vl r+ er
VIMSS60201 8 SPCVHVCALD-EQDICIGCQRTAAEITRWGLMSNDERREVLGRCFER 53
9*********.*********************************988 PP
Or compare VIMSS60201 to CDD or PaperBLAST