VIMSS60354 has 175 amino acids
Query: DUF4123 [M=119] Accession: PF13503.11 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.4 1.7 1.9e-31 95.0 1.7 1.2 1 VIMSS60354 Domain annotation for each sequence (and alignments): >> VIMSS60354 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.0 1.7 1.9e-31 1.9e-31 1 119 [] 17 144 .. 17 144 .. 0.94 Alignments for each domain: == domain 1 score: 95.0 bits; conditional E-value: 1.9e-31 DUF4123 1 lYallDgaldpellellealsgeaase.LyagtpeeelaevgPwLveleda.........sallr..eeegwgpslgwllaSalplealaahlrsllqv 87 l+al+Dga++ +l+ +le+ +ge +s+ L+ag++++e+a++gP+L+e +d+ + + ++++ p+++w l+S++++e+la+h+ ll+ VIMSS60354 17 LFALADGARYLTLDTRLEKAAGEIRSRwLLAGSELDEIAHAGPVLIEFMDSaplsssgefL--GWlrDWDRRSPMASW-LWSRASFENLAKHFAGLLFT 112 79*************************************************8888877443..336699*********.******************** PP DUF4123 88 rlpdgeevllRfydprvlrallqtldeeqrsa 119 r+pdg+++llR+y p+v ral q+++++q+++ VIMSS60354 113 RMPDGRRALLRYYSPEVRRALEQVMTARQWTQ 144 *****************************986 PP
Or compare VIMSS60354 to CDD or PaperBLAST