VIMSS618836 has 90 amino acids
Query: DUF1145 [M=58]
Accession: PF06611.16
Description: Protein of unknown function (DUF1145)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.6e-31 91.8 8.0 1.4e-30 91.3 8.0 1.3 1 VIMSS618836
Domain annotation for each sequence (and alignments):
>> VIMSS618836
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.3 8.0 1.4e-30 1.4e-30 1 58 [] 1 58 [. 1 58 [. 0.98
Alignments for each domain:
== domain 1 score: 91.3 bits; conditional E-value: 1.4e-30
DUF1145 1 mlinlGkllmlvvWlvllvNliqPfpgplnillniagivlvlmHllqlllfkaalkkk 58
m+inlG+llml+vW+++l+Nl+qP+p+pl +++++a+i++vlmH+lql+l+k++++k+
VIMSS618836 1 MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMHGLQLVLLKSTQPKD 58
89*****************************************************996 PP
Or compare VIMSS618836 to CDD or PaperBLAST