PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61893 to PF06568 (DUF1127)

VIMSS61893 has 67 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    8.3e-15   40.7   6.3    8.3e-15   40.7   6.3    1.5  2  VIMSS61893  


Domain annotation for each sequence (and alignments):
>> VIMSS61893  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.5   0.2      0.52      0.52       9      13 ..      14      18 ..      13      19 .. 0.53
   2 !   40.7   6.3   8.3e-15   8.3e-15       1      37 []      22      58 ..      22      58 .. 0.95

  Alignments for each domain:
  == domain 1  score: -3.5 bits;  conditional E-value: 0.52
     DUF1127  9 rrrRr 13
                r +Rr
  VIMSS61893 14 RSNRR 18
                45555 PP

  == domain 2  score: 40.7 bits;  conditional E-value: 8.3e-15
     DUF1127  1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
                l+ +++ W+rr ++rr+LarL+ r+LaD G+s+++++
  VIMSS61893 22 LLGTMKLWQRRIQSRRQLARLDSRLLADAGISEAQRY 58
                6789******************************985 PP



Or compare VIMSS61893 to CDD or PaperBLAST