PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS61907 to PF06568 (DUF1127)

VIMSS61907 has 70 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.16
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    9.2e-17   46.9   0.3    1.1e-16   46.6   0.3    1.1  1  VIMSS61907  


Domain annotation for each sequence (and alignments):
>> VIMSS61907  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.6   0.3   1.1e-16   1.1e-16       1      37 []      25      61 ..      25      61 .. 0.95

  Alignments for each domain:
  == domain 1  score: 46.6 bits;  conditional E-value: 1.1e-16
     DUF1127  1 lraalrrWrryRrtrreLarLsDreLaDIGLsRsdir 37
                l+++l++Wr+++r+r++La++s+++LaD+ +s+s+++
  VIMSS61907 25 LLEKLNSWRQNARSRKHLAQMSEHDLADLAISPSERY 61
                6789******************************985 PP



Or compare VIMSS61907 to CDD or PaperBLAST