VIMSS621073 has 79 amino acids
Query: DUF1480 [M=78]
Accession: PF07351.17
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-52 160.5 0.5 4.5e-52 160.4 0.5 1.0 1 VIMSS621073
Domain annotation for each sequence (and alignments):
>> VIMSS621073
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 160.4 0.5 4.5e-52 4.5e-52 1 78 [] 1 78 [. 1 78 [. 0.99
Alignments for each domain:
== domain 1 score: 160.4 bits; conditional E-value: 4.5e-52
DUF1480 1 msktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
m+k++++i++fe+dda+lss++kge+tlsiPcksdpdlcmqld+wde+tsiPail+gkd+lly++hyd+++dawvm+v
VIMSS621073 1 MGKSIVKIRQFEVDDAELSSQTKGEHTLSIPCKSDPDLCMQLDGWDENTSIPAILDGKDTLLYKQHYDQHQDAWVMKV 78
99**************************************************************************97 PP
Or compare VIMSS621073 to CDD or PaperBLAST