VIMSS642438 has 169 amino acids
Query: NTPase_I-T [M=162] Accession: PF01931.22 Description: Protein of unknown function DUF84 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-50 156.3 0.0 3.8e-50 156.1 0.0 1.0 1 VIMSS642438 Domain annotation for each sequence (and alignments): >> VIMSS642438 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 156.1 0.0 3.8e-50 3.8e-50 1 156 [. 6 157 .. 6 162 .. 0.97 Alignments for each domain: == domain 1 score: 156.1 bits; conditional E-value: 3.8e-50 NTPase_I-T 1 gskNpvKieAveeafeklfkevevegvsvpsgvseqPlgdeetlkGAinRaknalekaeadygVGiEgGveelegklldvawaavidkegrvsvgrsa 98 gskN++K+ Ave++ + ++e++++svpsgv++qP++deet++GAinRak+ale+ +a++g+G+EgGv ++e++l+ ++w a ++++g++ v+ +a VIMSS642438 6 GSKNKTKVGAVEKVWK----DAEITSLSVPSGVAAQPFSDEETMQGAINRAKRALEEGDAQIGIGLEGGVMKTEHGLFMCNWGALATSDGKIFVAGGA 99 8**********98776....679**********************************99*************************************** PP NTPase_I-T 99 afelPeevveeiregeelgevmdelfgtenikekeGaigllTkglvtRkdlyeqavil 156 +++lP+++++ ++eg+el+evm+e++++++i+++eGaig++T++ v+R++l+ + v l VIMSS642438 100 RITLPDDFLAPLEEGKELSEVMEEFVQRKDIRSHEGAIGIFTDDYVDRTELFVHVVKL 157 ***************************************************9998865 PP
Or compare VIMSS642438 to CDD or PaperBLAST