VIMSS6577249 has 356 amino acids
Query: DUF384 [M=55]
Accession: PF04064.17
Description: Domain of unknown function (DUF384)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-29 88.2 3.6 4.6e-29 86.5 3.6 2.0 1 VIMSS6577249
Domain annotation for each sequence (and alignments):
>> VIMSS6577249
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.5 3.6 4.6e-29 4.6e-29 1 55 [] 283 337 .. 283 337 .. 0.98
Alignments for each domain:
== domain 1 score: 86.5 bits; conditional E-value: 4.6e-29
DUF384 1 sLllLcttregReylRskgvYpilRelHkaeedekvreacerlVqlLirdEeeee 55
+L+lL++tregRe++R+++vYpi+RelH++++de++re c++lVq+L+rdE++ee
VIMSS6577249 283 TLVLLTATREGREHMRRRKVYPIIRELHLNVDDEEIREVCDQLVQMLVRDEAPEE 337
89*************************************************9985 PP
Or compare VIMSS6577249 to CDD or PaperBLAST