VIMSS6577402 has 262 amino acids
Query: GDT1 [M=75] Accession: PF01169.24 Description: Divalent cation/proton antiporter GDT1 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-45 138.0 15.3 7.9e-27 79.8 2.5 2.1 2 VIMSS6577402 Domain annotation for each sequence (and alignments): >> VIMSS6577402 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.1 5.1 6.2e-22 6.2e-22 3 75 .] 30 102 .. 28 102 .. 0.96 2 ! 79.8 2.5 7.9e-27 7.9e-27 2 75 .] 181 254 .. 180 254 .. 0.98 Alignments for each domain: == domain 1 score: 64.1 bits; conditional E-value: 6.2e-22 GDT1 3 sflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaallFlvfG 75 s+++i+ +ElGDk++++t++LA +y +Vf+G++lAl+++t +avl+G++ +p+++++++++ lFl+fG VIMSS6577402 30 SISMIIGCELGDKSFIVTALLAYQYGRASVFFGSYLALFFMTSFAVLVGRAAPFLFPKSITHILGGTLFLIFG 102 789**********************9999********************999889*****************9 PP == domain 2 score: 79.8 bits; conditional E-value: 7.9e-27 GDT1 2 tsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaallFlvfG 75 ++f+lif++ElGD++q+ati+++a++k+l Vf+G+ ++++l+t++av++G+++++++ + v ++++++F++fG VIMSS6577402 181 KAFALIFVSELGDRSQIATIVMSAKEKVLDVFIGVNIGHMLCTMVAVIVGRYISNKIEMYKVLFFGGIVFMIFG 254 79***********************************************************************9 PP
Or compare VIMSS6577402 to CDD or PaperBLAST