PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581170 to PF04418 (DUF543)

VIMSS6581170 has 97 amino acids

Query:       DUF543  [M=75]
Accession:   PF04418.17
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.2e-36  109.9   0.2    2.9e-36  109.6   0.2    1.2  1  VIMSS6581170  


Domain annotation for each sequence (and alignments):
>> VIMSS6581170  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.6   0.2   2.9e-36   2.9e-36       6      75 .]      19      87 ..       4      87 .. 0.86

  Alignments for each domain:
  == domain 1  score: 109.6 bits;  conditional E-value: 2.9e-36
        DUF543  6 kkkkskpssesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasFr 75
                  ++k+ + + +++l+ kwD +Lsn+lvkt++G+gvGv++svl+f+rRa+pvwlG+GfG+Gr+Yae+da+Fr
  VIMSS6581170 19 SNKNGSSV-STILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
                  23333333.69**********************************************************6 PP



Or compare VIMSS6581170 to CDD or PaperBLAST