VIMSS6581659 has 199 amino acids
Query: DUF846 [M=139] Accession: PF05832.16 Description: Eukaryotic protein of unknown function (DUF846) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-52 163.6 9.4 1.8e-52 163.3 9.4 1.1 1 VIMSS6581659 Domain annotation for each sequence (and alignments): >> VIMSS6581659 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 163.3 9.4 1.8e-52 1.8e-52 1 139 [] 15 156 .. 15 156 .. 0.96 Alignments for each domain: == domain 1 score: 163.3 bits; conditional E-value: 1.8e-52 DUF846 1 shpvallfhllfkllailvyllgslfsssfilsfvivilllaldfwlvknitGrlLVglrWwnevde.dgeskwvFesr...eekrkvnaidsklFW 93 shp++l+fhl+ k+++i++y++gs+f +f+ +f++v+lll++df+l+knitGr+LV+lrWw++ ++ +++s+++Fes+ + ++naidsklFW VIMSS6581659 15 SHPLLLSFHLAGKAVPIVFYIIGSMFL-NFTPQFITVVLLLSFDFYLTKNITGRKLVQLRWWYDSTDvNKDSNFTFESYkqyAPGPPINAIDSKLFW 110 7***********************996.9***********************************999788999******777778888********* PP DUF846 94 lalyvtpllwilllilallslkflwlllviialvlsltnllgfvkc 139 +++yvtp++w ++++l+ll+lk+++l+lvi+a++l+++n++gf c VIMSS6581659 111 WSMYVTPVIWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCC 156 *******************************************999 PP
Or compare VIMSS6581659 to CDD or PaperBLAST