VIMSS6584210 has 86 amino acids
Query: UPF0203 [M=69]
Accession: PF05254.16
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-33 101.6 3.1 1.3e-33 101.4 3.1 1.0 1 VIMSS6584210
Domain annotation for each sequence (and alignments):
>> VIMSS6584210
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 101.4 3.1 1.3e-33 1.3e-33 1 69 [] 7 75 .. 7 75 .. 0.98
Alignments for each domain:
== domain 1 score: 101.4 bits; conditional E-value: 1.3e-33
UPF0203 1 aslapeCtelKekYdkCFnkWysekflkgkskeeeCeklfkeYqeCvqkalkekgieklleeareeapl 69
as+apeCt+lK+kYd+CFn+Wysekflkgks e+eC+k++ +Y +Cv++al ++gi+++l+eareeap+
VIMSS6584210 7 ASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREEAPF 75
599***************************************************************985 PP
Or compare VIMSS6584210 to CDD or PaperBLAST