VIMSS665900 has 55 amino acids
Query: VraX [M=55]
Accession: PF17412.6
Description: Family of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-43 132.9 1.2 1.3e-43 132.8 1.2 1.0 1 VIMSS665900
Domain annotation for each sequence (and alignments):
>> VIMSS665900
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 132.8 1.2 1.3e-43 1.3e-43 1 55 [] 1 55 [] 1 55 [] 0.99
Alignments for each domain:
== domain 1 score: 132.8 bits; conditional E-value: 1.3e-43
VraX 1 miiYRryieeGaPvYeiitktFktvsikCDesFsdteiykLLsLLedDvDnmkvs 55
miiYR+y +eGaPvYeiitktF++vsikCD+sFsdtei+kLLsLL+dD+D+mkvs
VIMSS665900 1 MIIYRQYQHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS 55
9*****************************************************8 PP
Or compare VIMSS665900 to CDD or PaperBLAST