VIMSS665900 has 55 amino acids
Query: VraX [M=55] Accession: PF17412.7 Description: Family of unknown function Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-43 132.9 1.2 1.3e-43 132.8 1.2 1.0 1 VIMSS665900 Domain annotation for each sequence (and alignments): >> VIMSS665900 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 132.8 1.2 1.3e-43 1.3e-43 1 55 [] 1 55 [] 1 55 [] 0.99 Alignments for each domain: == domain 1 score: 132.8 bits; conditional E-value: 1.3e-43 VraX 1 miiYRryieeGaPvYeiitktFktvsikCDesFsdteiykLLsLLedDvDnmkvs 55 miiYR+y +eGaPvYeiitktF++vsikCD+sFsdtei+kLLsLL+dD+D+mkvs VIMSS665900 1 MIIYRQYQHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS 55 9*****************************************************8 PP
Or compare VIMSS665900 to CDD or PaperBLAST