VIMSS680884 has 189 amino acids
Query: DUF308 [M=73] Accession: PF03729.17 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-27 80.8 34.8 3.7e-17 48.7 16.3 3.1 3 VIMSS680884 Domain annotation for each sequence (and alignments): >> VIMSS680884 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.7 16.3 3.7e-17 3.7e-17 1 72 [. 26 97 .. 26 98 .. 0.97 2 ! 44.8 10.6 6.1e-16 6.1e-16 1 72 [. 84 153 .. 84 154 .. 0.95 3 ! 4.3 1.2 0.0026 0.0026 17 42 .. 157 182 .. 151 189 .] 0.80 Alignments for each domain: == domain 1 score: 48.7 bits; conditional E-value: 3.7e-17 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllll 72 ++++ll++ Gi++li+P+a+++al+++iG+lll+sGi+ +v+ +a+r+ + ++ + +l+G+ yi++G++++ VIMSS680884 26 IVAVLLLLGGIFCLINPLASGAALSMVIGILLLLSGIAMIVGMIANRSDNFWPMVAGILLGVAYIVMGYVFI 97 789*********************************************9999999***************98 PP == domain 2 score: 44.8 bits; conditional E-value: 6.1e-16 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfwllllsGilyiiaGllll 72 llG+++i+ G +++++P + ++ l+++++vl+ ++G+++l+++f ++ ++ g wl++l+G+l++++ +ll+ VIMSS680884 84 LLGVAYIVMGYVFITNPAIGMISLAVVLAVLFAFGGVLRLINGF--KDLKRPGAWLQILLGVLDLVITYLLV 153 68******************************************..8888999*************988775 PP == domain 3 score: 4.3 bits; conditional E-value: 0.0026 DUF308 17 PgaallalviliGvlllvsGivqlva 42 P+++++++++l+G+ +l+s++ ++ VIMSS680884 157 PLMSITMVTTLVGIEMLFSSFSCFMV 182 999****************9987754 PP
Or compare VIMSS680884 to CDD or PaperBLAST