VIMSS6963014 has 373 amino acids
Query: DUF5009 [M=260] Accession: PF16401.11 Description: Domain of unknown function (DUF5009) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 36.9 3.0 1.4e-13 36.9 3.0 2.6 3 VIMSS6963014 Domain annotation for each sequence (and alignments): >> VIMSS6963014 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.9 3.0 1.4e-13 1.4e-13 3 113 .. 13 119 .. 11 173 .. 0.80 2 ? -0.8 1.9 0.045 0.045 229 260 .] 270 302 .. 262 302 .. 0.79 3 ? -2.0 0.0 0.1 0.1 174 205 .. 341 372 .. 332 373 .] 0.78 Alignments for each domain: == domain 1 score: 36.9 bits; conditional E-value: 1.4e-13 DUF5009 3 ssldalrgiaillmvlsgsiafgsilpg.wmyhaqvppp..ahkfkpelpgitwvdlvfpfflfamgaaiplalkkkievssllkillsivkryvll 96 +++dalrg ++ l+g +a+ ++ g +++ + p h + g + dlv+p+flf +g+a+p+++ k+i +++l+ki+l++++r v+l VIMSS6963014 13 AAIDALRGFDMF--FLTGGLAL--VVAGiNLFYDRSPEWlvKHSTHVAWEGFAAWDLVMPLFLFIVGTAMPFSFSKRIGSEPLWKIYLKVARRVVVL 105 679999999865..57899998..5555146777777652256666667899999***************************************998 PP DUF5009 97 affalftmharawvlsa 113 ++ m + +ls VIMSS6963014 106 FLLG---MVVQGNLLSF 119 6554...4445555555 PP == domain 2 score: -0.8 bits; conditional E-value: 0.045 DUF5009 229 lynwspalwlykf.yylkylfivlpstlvgewl 260 l+ s lw+ + y+l +lf +l l +wl VIMSS6963014 270 LFTSSMVLWAAGWcYFLLFLFYLLTDVLKLNWL 302 677788888876438899999999999988886 PP == domain 3 score: -2.0 bits; conditional E-value: 0.1 DUF5009 174 lfqndiiilvlanmalfasliwlltakklwlr 205 + ++d ++ l+n al+ +++++ +++ +++ VIMSS6963014 341 FGDADRFVFYLCNYALIWGVLYYMYKNRTFIK 372 56778889999999999999999988888776 PP
Or compare VIMSS6963014 to CDD or PaperBLAST