PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7194 to PF06288 (DUF1040)

VIMSS7194 has 88 amino acids

Query:       DUF1040  [M=86]
Accession:   PF06288.18
Description: Protein of unknown function (DUF1040)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    3.2e-48  148.4   0.4    3.5e-48  148.3   0.4    1.0  1  VIMSS7194  


Domain annotation for each sequence (and alignments):
>> VIMSS7194  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  148.3   0.4   3.5e-48   3.5e-48       1      86 []       1      86 [.       1      86 [. 1.00

  Alignments for each domain:
  == domain 1  score: 148.3 bits;  conditional E-value: 3.5e-48
    DUF1040  1 mkchrinellellepeWkkekdlnllqllqklaeeagfekkleeltddvliyhlkmresdkeemiPGlkkdveedfktallkarGi 86
               mkc+r+ne+lell+++W+k++dl+l+++lqk+a+e+gf+k+l+eltd+v+iy+lkm+++dk e iPGlkkd+eedfktall+arGi
  VIMSS7194  1 MKCKRLNEVLELLQSYWSKDSDLSLMEILQKIANESGFQKPLNELTDEVIIYQLKMDGTDKYEPIPGLKKDYEEDFKTALLRARGI 86
               9************************************************************************************8 PP



Or compare VIMSS7194 to CDD or PaperBLAST