VIMSS7194 has 88 amino acids
Query: DUF1040 [M=86]
Accession: PF06288.18
Description: Protein of unknown function (DUF1040)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-48 148.4 0.4 3.5e-48 148.3 0.4 1.0 1 VIMSS7194
Domain annotation for each sequence (and alignments):
>> VIMSS7194
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 148.3 0.4 3.5e-48 3.5e-48 1 86 [] 1 86 [. 1 86 [. 1.00
Alignments for each domain:
== domain 1 score: 148.3 bits; conditional E-value: 3.5e-48
DUF1040 1 mkchrinellellepeWkkekdlnllqllqklaeeagfekkleeltddvliyhlkmresdkeemiPGlkkdveedfktallkarGi 86
mkc+r+ne+lell+++W+k++dl+l+++lqk+a+e+gf+k+l+eltd+v+iy+lkm+++dk e iPGlkkd+eedfktall+arGi
VIMSS7194 1 MKCKRLNEVLELLQSYWSKDSDLSLMEILQKIANESGFQKPLNELTDEVIIYQLKMDGTDKYEPIPGLKKDYEEDFKTALLRARGI 86
9************************************************************************************8 PP
Or compare VIMSS7194 to CDD or PaperBLAST