VIMSS7196 has 111 amino acids
Query: DUF413 [M=90]
Accession: PF04219.16
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-41 125.8 0.8 3.2e-41 125.6 0.8 1.0 1 VIMSS7196
Domain annotation for each sequence (and alignments):
>> VIMSS7196
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 125.6 0.8 3.2e-41 3.2e-41 1 87 [. 10 96 .. 10 99 .. 0.98
Alignments for each domain:
== domain 1 score: 125.6 bits; conditional E-value: 3.2e-41
DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvg 87
rF+Ddkn+prGfsr+Gd+tike+++LeqyGqa+kaL+ ge+ep+t+eek fv++++ge+aae+ +ek+W kY +i++kkr++tl++
VIMSS7196 10 RFFDDKNYPRGFSRHGDYTIKESQVLEQYGQAFKALDLGEREPATKEEKDFVAFCRGERAAETFFEKTWNKYRTRINTKKRVYTLSS 96
8***********************************************************************************986 PP
Or compare VIMSS7196 to CDD or PaperBLAST