VIMSS73192 has 168 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-58 183.7 9.3 1.4e-58 183.6 9.3 1.0 1 VIMSS73192 Domain annotation for each sequence (and alignments): >> VIMSS73192 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 183.6 9.3 1.4e-58 1.4e-58 2 158 .. 8 164 .. 7 165 .. 0.97 Alignments for each domain: == domain 1 score: 183.6 bits; conditional E-value: 1.4e-58 DUF892 2 leelfideLrDayaaEkqalkalpkmakaaespeLkaaleqHleeTeqqierleqvferlge.easekkcdameglvaegqelleeaiedeevkdaali 99 +e++fi+ L D y+aEkq++kal+k+ ++a s++L+aa+++Hl+eT++qier++qv+ + ++ + +++kc amegl++e++e++e+ +++ev+daali VIMSS73192 8 VEDIFIHLLSDTYSAEKQLTKALSKLSRSAYSDKLTAAFQSHLDETHGQIERIDQVVDSEDGlKLKRIKCAAMEGLIEEANEVIES-TDKNEVRDAALI 105 68*******************************************************98765389********************9.99********** PP DUF892 100 aaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 aaaq+vehyEiasYgtL++lAeqlg ++aa+lL++tl+eEkatd kLt+la + vn++a VIMSS73192 106 AAAQKVEHYEIASYGTLVTLAEQLGYKKAAKLLKETLEEEKATDVKLTDLAFNNVNKKA 164 ********************************************************997 PP
Or compare VIMSS73192 to CDD or PaperBLAST