VIMSS73531 has 65 amino acids
Query: HGLS [M=386]
Accession: PF07063.19
Description: 2-oxoadipate dioxygenase/decarboxylase
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-14 39.6 0.1 2.4e-14 39.4 0.1 1.0 1 VIMSS73531
Domain annotation for each sequence (and alignments):
>> VIMSS73531
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 39.4 0.1 2.4e-14 2.4e-14 1 40 [. 14 53 .. 14 63 .. 0.87
Alignments for each domain:
== domain 1 score: 39.4 bits; conditional E-value: 2.4e-14
HGLS 1 flaalsemYkeevPlygtllelvaevnaevlaadpalera 40
f++a+s+mY++evP+ygtllelva+vn +vl+++p+l+++
VIMSS73531 14 FSQAMSAMYQQEVPQYGTLLELVADVNLAVLENNPQLHEK 53
89*********************************95444 PP
Or compare VIMSS73531 to CDD or PaperBLAST