VIMSS74024 has 60 amino acids
Query: DUF1869 [M=59]
Accession: PF08956.14
Description: Domain of unknown function (DUF1869)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-37 111.4 1.8 8.3e-37 111.3 1.8 1.0 1 VIMSS74024
Domain annotation for each sequence (and alignments):
>> VIMSS74024
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.3 1.8 8.3e-37 8.3e-37 2 59 .] 3 60 .] 2 60 .] 0.98
Alignments for each domain:
== domain 1 score: 111.3 bits; conditional E-value: 8.3e-37
DUF1869 2 eaefllTvTNknNGVSVDkdfsslaeLkdpevaAdvvKdLiNivRgYdsdeetnvCGW 59
+a++++TvTN++NGVSVD++++++++L +pevaA+v+KdL+N+vR+Yd+++e++vCGW
VIMSS74024 3 KATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60
799******************************************************* PP
Or compare VIMSS74024 to CDD or PaperBLAST