VIMSS7418 has 124 amino acids
Query: DUF423 [M=87]
Accession: PF04241.19
Description: Protein of unknown function (DUF423)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-30 90.2 2.3 5.9e-30 89.7 2.3 1.2 1 VIMSS7418
Domain annotation for each sequence (and alignments):
>> VIMSS7418
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.7 2.3 5.9e-30 5.9e-30 1 87 [] 19 104 .. 19 104 .. 0.98
Alignments for each domain:
== domain 1 score: 89.7 bits; conditional E-value: 5.9e-30
DUF423 1 lGAfGaHglkkkleeeqlevfetavqYqlyhalallavallaeaaaakllklagllflaGivlFSgslyllaltgdkllgaitPiGG 87
lGAf+aHgl++ le+++l++++t+ +Yq++h++a+laval +++k +l++ +l+Gi+lFSgsly+la+ +++ +itPiGG
VIMSS7418 19 LGAFAAHGLSHILEAKALSWIDTGLEYQMFHTIAVLAVALS-ALRDNKFARLSMSSWLIGILLFSGSLYALAFEASNVIVWITPIGG 104
7***********999*************************7.8999****************************************9 PP
Or compare VIMSS7418 to CDD or PaperBLAST