VIMSS744023 has 101 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.1e-22 64.2 0.1 7e-22 64.0 0.1 1.1 1 VIMSS744023
Domain annotation for each sequence (and alignments):
>> VIMSS744023
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 64.0 0.1 7e-22 7e-22 1 78 [. 14 90 .. 14 91 .. 0.96
Alignments for each domain:
== domain 1 score: 64.0 bits; conditional E-value: 7e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+ Id++D+++++ l Rm+++k++ ++K ++ ++ peR++++l +r++ae++gld +ve+++ ++i++ +++Q
VIMSS744023 14 REAIDRLDADIIAALGARMQYVKAASRFKP-TEASIAAPERVAAMLPDRRRWAEQAGLDGAFVEALYAQVIAWYIEQQ 90
99***************************6.6669*****************************************99 PP
Or compare VIMSS744023 to CDD or PaperBLAST