VIMSS745696 has 169 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-54 169.2 4.4 4.4e-54 169.0 4.4 1.0 1 VIMSS745696 Domain annotation for each sequence (and alignments): >> VIMSS745696 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.0 4.4 4.4e-54 4.4e-54 1 157 [. 3 156 .. 3 158 .. 0.98 Alignments for each domain: == domain 1 score: 169.0 bits; conditional E-value: 4.4e-54 DUF892 1 tleelfideLrDayaaEkqalkalpkmakaaes.peLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkdaa 97 t++e++ d+LrDaya+E++a+++l+++a+++++ p L+++++qH+eeT +q++ le +++rl++++s++k d++++ +a gq++++ +++de+vk+a+ VIMSS745696 3 TPQEHLEDWLRDAYAMERHAETMLKAQAARLDNyPVLRDRIQQHVEETLEQQRLLESCLQRLDTSPSAIK-DLAARAAAYGQAASGLFVADEVVKGAM 99 679*******************************************************************.*************************** PP DUF892 98 liaaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqe 157 a++++eh EiasY+tLia+A+ +ge+e+++++e++l++E +++e++++++++++ ++ VIMSS745696 100 ---AGYVFEHVEIASYKTLIAAAQLAGENEIRDCCERILKQEVDMAEWMSQHLPDIAVAF 156 ...***************************************************998766 PP
Or compare VIMSS745696 to CDD or PaperBLAST