VIMSS7515 has 114 amino acids
Query: DUF496 [M=93]
Accession: PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-41 126.4 13.8 2.5e-41 126.1 13.8 1.1 1 VIMSS7515
Domain annotation for each sequence (and alignments):
>> VIMSS7515
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.1 13.8 2.5e-41 2.5e-41 1 92 [. 9 100 .. 9 101 .. 0.99
Alignments for each domain:
== domain 1 score: 126.1 bits; conditional E-value: 2.5e-41
DUF496 1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklke 92
+++vle+vr+ r kn++kr++edn++kirdn+kr+ ll+nl +yi+++m+++e++ iie m++dye rvddy+i++aelsk+rre s+k+ke
VIMSS7515 9 FQDVLEYVRMYRLKNRIKRDMEDNNRKIRDNQKRILLLDNLNQYIRDDMTIAEVRGIIESMRDDYESRVDDYTIRNAELSKQRREASTKMKE 100
689***************************************************************************************96 PP
Or compare VIMSS7515 to CDD or PaperBLAST