VIMSS7526966 has 398 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-20 57.4 0.0 1.6e-19 56.4 0.0 1.6 1 VIMSS7526966
Domain annotation for each sequence (and alignments):
>> VIMSS7526966
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.4 0.0 1.6e-19 1.6e-19 1 79 [] 12 90 .. 12 90 .. 0.98
Alignments for each domain:
== domain 1 score: 56.4 bits; conditional E-value: 1.6e-19
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
Rk I ++D+ell ++a+R +l+ ++a+yK +n +++d+ Re+++l +l ++ e g+ p+++ ++f+ ii+ s++ Q+
VIMSS7526966 12 RKAISSLDSELLSIFAQRRQLSLQVAAYKFDNSGQIRDEGREKKLLTQLVDKGLEFGIAPNTTLTLFHSIIEDSVRSQY 90
99*************************************************999**********************996 PP
Or compare VIMSS7526966 to CDD or PaperBLAST