VIMSS75470 has 118 amino acids
Query: DUF805 [M=107]
Accession: PF05656.18
Description: Protein of unknown function (DUF805)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-38 118.1 2.8 1.4e-38 117.9 2.8 1.0 1 VIMSS75470
Domain annotation for each sequence (and alignments):
>> VIMSS75470
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 117.9 2.8 1.4e-38 1.4e-38 1 107 [] 11 113 .. 11 113 .. 0.96
Alignments for each domain:
== domain 1 score: 117.9 bits; conditional E-value: 1.4e-38
DUF805 1 yfsfsGRarRkeywwfvlvlvlvlivlllllallgasallgsalalllalllllpsllavtvRRlHDigrsgwwlllllipliglivllvllllpgtpg 99
y+ fsGRarRkeyw+f+l++++v +++ ++ +lg+ l++l++l+++lp la+++RRlHD++rsg w+ll+++p+ig++vllv+++++gt+g
VIMSS75470 11 YVGFSGRARRKEYWMFTLINAIVGAIINVIQLILGL---ELPYLSMLYLLATFLPV-LALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSG 105
899******************************965...567899***********.****************************************** PP
DUF805 100 enrYGpdp 107
+nrYG+dp
VIMSS75470 106 SNRYGNDP 113
******98 PP
Or compare VIMSS75470 to CDD or PaperBLAST