VIMSS754991 has 372 amino acids
Query: DUF5009 [M=260]
Accession: PF16401.11
Description: Domain of unknown function (DUF5009)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.8e-10 25.6 3.0 3.8e-10 25.6 3.0 3.3 3 VIMSS754991
Domain annotation for each sequence (and alignments):
>> VIMSS754991
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.6 3.0 3.8e-10 3.8e-10 4 102 .. 13 99 .. 10 107 .. 0.83
2 ? -0.4 0.1 0.035 0.035 27 54 .. 148 175 .. 111 188 .. 0.71
3 ? -2.8 1.5 0.18 0.18 207 215 .. 268 276 .. 199 327 .. 0.54
Alignments for each domain:
== domain 1 score: 25.6 bits; conditional E-value: 3.8e-10
DUF5009 4 sldalrgiaillmvlsgsiafgsilpgwmyhaqvpppahkfkpelpgitwvdlvfpfflfamgaaiplalkkkievssllkillsivkryvllaffal 101
sld +rg++i+lm++ a i p p + + + g t dlvfpfflf +g + ++lk+++e ++ ++ i++r v+l ++ l
VIMSS754991 13 SLDVFRGMTIVLMIIVNGQAA--ID---------PYPIFE-HVDWNGCTLADLVFPFFLFIVGLTSVISLKNQMERKAKTSLYSAIIERSVVLFLLGL 98
889999999999886555443..33.........334433.35899*********************************************9998888 PP
DUF5009 102 f 102
f
VIMSS754991 99 F 99
7 PP
== domain 2 score: -0.4 bits; conditional E-value: 0.035
DUF5009 27 ilpgwmyhaqvpppahkfkpelpgitwv 54
+l w+ +qvp p++ +wv
VIMSS754991 148 LLGYWIIMTQVPVPGYGANQLTKDGSWV 175
4556888899998887655544444555 PP
== domain 3 score: -2.8 bits; conditional E-value: 0.18
DUF5009 207 gllpfvmav 215
ll f ++
VIMSS754991 268 ALLVFAFCY 276
233333333 PP
Or compare VIMSS754991 to CDD or PaperBLAST