VIMSS754991 has 372 amino acids
Query: DUF5009 [M=260] Accession: PF16401.9 Description: Domain of unknown function (DUF5009) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-10 25.9 8.9 3.5e-10 25.9 8.9 3.1 2 VIMSS754991 Domain annotation for each sequence (and alignments): >> VIMSS754991 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.9 8.9 3.5e-10 3.5e-10 3 134 .. 12 132 .. 10 167 .. 0.70 2 ? -4.3 3.4 0.55 0.55 154 154 .. 296 296 .. 227 363 .. 0.61 Alignments for each domain: == domain 1 score: 25.9 bits; conditional E-value: 3.5e-10 DUF5009 3 ksldalrGiaillmvlsasiafsilpgwmyhaqvpppghkfkpelpGitwvdlvfpfflfamGaaiplalkkkvekgssklkvlldiikrfvlltffa 100 sld +rG++i+lm++ a +i p p + + + G t dlvfpfflf +G + ++lk+++e ++k ++ ii+r v l ++ VIMSS754991 12 LSLDVFRGMTIVLMIIVNGQA-AI---------DPYPIFE-HVDWNGCTLADLVFPFFLFIVGLTSVISLKNQME-RKAKTSLYSAIIERSVVLFLLG 97 688999999998888655433.22.........3333333.35899***************************99.889999999************* PP DUF5009 101 lftmharsyvlssepelkeqllsi.vcfvllflly 134 lf + + + + l i vc+++ ++y VIMSS754991 98 LFLNVFPHPIEFDSIRIYGILQRIaVCYLISAFIY 132 *9876644333333333333333323444444444 PP == domain 2 score: -4.3 bits; conditional E-value: 0.55 DUF5009 154 f 154 + VIMSS754991 296 M 296 2 PP
Or compare VIMSS754991 to CDD or PaperBLAST