VIMSS76270 has 205 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-19 56.0 0.0 3.1e-19 55.0 0.0 1.6 1 VIMSS76270
Domain annotation for each sequence (and alignments):
>> VIMSS76270
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.0 0.0 3.1e-19 3.1e-19 1 55 [. 142 196 .. 142 197 .. 0.98
Alignments for each domain:
== domain 1 score: 55.0 bits; conditional E-value: 3.1e-19
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsG 55
l+c+Y+ql +++lL+q +++i +++Y++ V l+v++p+++v++f+++L+++++G
VIMSS76270 142 LQCEYSQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRG 196
79****************************************************9 PP
Or compare VIMSS76270 to CDD or PaperBLAST