VIMSS7776 has 106 amino acids
Query: DUF446 [M=98]
Accession: PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-37 113.5 6.0 2.2e-37 113.4 6.0 1.0 1 VIMSS7776
Domain annotation for each sequence (and alignments):
>> VIMSS7776
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 113.4 6.0 2.2e-37 2.2e-37 2 98 .] 5 100 .. 4 100 .. 0.97
Alignments for each domain:
== domain 1 score: 113.4 bits; conditional E-value: 2.2e-37
DUF446 2 vaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelDel 98
++++Le+l+ ++++l+lWq+ +p++ea+ s+ePF++dt+++eeWLqwvfiprm+al+e++++LP+++ai+p++eea+ke +e ++ll+ l +l+el
VIMSS7776 5 TKQHLEQLQITMQQLNLWQTMPPAAEAFLSEEPFSIDTMSAEEWLQWVFIPRMQALLESGSALPNKIAISPYIEEAMKEFNE-LQQLLTPLVALEEL 100
789*****************************************************************************99.********999875 PP
Or compare VIMSS7776 to CDD or PaperBLAST