VIMSS7791 has 107 amino acids
Query: DUF440 [M=101]
Accession: PF04269.17
Description: Protein of unknown function, DUF440
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.9e-49 150.5 3.1 8.8e-49 150.3 3.1 1.0 1 VIMSS7791
Domain annotation for each sequence (and alignments):
>> VIMSS7791
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 150.3 3.1 8.8e-49 8.8e-49 2 101 .] 8 107 .] 7 107 .] 0.98
Alignments for each domain:
== domain 1 score: 150.3 bits; conditional E-value: 8.8e-49
DUF440 2 ltedellekaydiFlelaadnLdpadillfnlefeerGaveevepeddWeeevgvevdkeefaevliGLeeeddelddiFarlLisrekeekechilWkk 101
l++d +++ aydiFle+a +nLdpadillfnl+feerG+ve ve++ddWeee+gv +d+ee+aev++GL +e+de+dd+Fa++Lis+++e++e+h++Wkk
VIMSS7791 8 LDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK 107
6799**********************************************************************************************96 PP
Or compare VIMSS7791 to CDD or PaperBLAST