VIMSS7849 has 63 amino acids
Query: DUF2635 [M=46]
Accession: PF10948.12
Description: Protein of unknown function (DUF2635)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-24 72.0 0.0 1.5e-24 71.8 0.0 1.1 1 VIMSS7849
Domain annotation for each sequence (and alignments):
>> VIMSS7849
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.8 0.0 1.5e-24 1.5e-24 1 46 [] 6 51 .. 6 51 .. 0.98
Alignments for each domain:
== domain 1 score: 71.8 bits; conditional E-value: 1.5e-24
DUF2635 1 vkPaeGlkVRdPetgqlLpaeGeevprtsyWlRRlkdGDVvlvkek 46
+kP++Gl +RdPet++lL+++Ge++p+ syWl++lk+GDV+lv+e+
VIMSS7849 6 IKPKTGLLIRDPETFELLSESGEDKPKISYWLNHLKNGDVELVTET 51
8******************************************985 PP
Or compare VIMSS7849 to CDD or PaperBLAST