VIMSS79594 has 114 amino acids
Query: DUF1508 [M=48] Accession: PF07411.16 Description: Domain of unknown function (DUF1508) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-42 129.1 2.9 3e-24 71.0 0.2 2.0 2 VIMSS79594 Domain annotation for each sequence (and alignments): >> VIMSS79594 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.0 0.2 3e-24 3e-24 1 46 [. 11 56 .. 11 58 .. 0.94 2 ! 59.1 0.3 1.6e-20 1.6e-20 1 48 [] 62 109 .. 62 109 .. 0.97 Alignments for each domain: == domain 1 score: 71.0 bits; conditional E-value: 3e-24 DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaev 46 +k+G+f+F+LkaaN +vI+tse Y s++aaengI+sV+kn+ d + VIMSS79594 11 AKDGQFMFNLKAANSQVILTSELYRSRSAAENGIASVQKNGLDEKN 56 69***************************************99875 PP == domain 2 score: 59.1 bits; conditional E-value: 1.6e-20 DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 +kn+k++F+Lka+N++ I++s+ Yss +a++gI sV kna+++ ++D VIMSS79594 62 AKNDKPYFVLKAKNHQEIGRSQYYSSSVSAKKGIVSVTKNAASTVIKD 109 69*****************************************99987 PP
Or compare VIMSS79594 to CDD or PaperBLAST