VIMSS79763 has 137 amino acids
Query: ZapG-like [M=123] Accession: PF06295.17 Description: Z-ring associated protein G-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-47 147.1 2.1 1.5e-47 146.9 2.1 1.0 1 VIMSS79763 Domain annotation for each sequence (and alignments): >> VIMSS79763 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 146.9 2.1 1.5e-47 1.5e-47 1 123 [] 12 135 .. 12 135 .. 0.98 Alignments for each domain: == domain 1 score: 146.9 bits; conditional E-value: 1.5e-47 ZapG-like 1 vliglvvGliiGavvlrltksklkkqkklekelekakaeleqyrqeledHfarsaelleklakdyqkLyqhlaksseeLlpelteqdlpvkkkleekkk 99 + iglv+Gli+G+++lrltk ++kkq ++e+el+k k++l++++q+le+Hf++saell+++a+dyqkLy+hla+ss++Llpelt++ l++++ +++++ VIMSS79763 12 AGIGLVIGLILGYLFLRLTKGSVKKQLQTETELQKVKNQLDNQKQQLEKHFSESAELLKNIAQDYQKLYKHLATSSTTLLPELTNKPLFSSHLITTEHV 110 57************************************************************************************************9 PP ZapG-like 100 dkee.eeaeeqPrDYaegasGllke 123 d+++ +++++++rDY+eg+sGll++ VIMSS79763 111 DRHDqRNKDDHRRDYCEGSSGLLRN 135 99987999**************985 PP
Or compare VIMSS79763 to CDD or PaperBLAST