VIMSS79911 has 112 amino acids
Query: DUF496 [M=93]
Accession: PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-39 119.3 17.2 3.7e-39 119.1 17.2 1.1 1 VIMSS79911
Domain annotation for each sequence (and alignments):
>> VIMSS79911
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.1 17.2 3.7e-39 3.7e-39 1 92 [. 9 100 .. 9 101 .. 0.99
Alignments for each domain:
== domain 1 score: 119.1 bits; conditional E-value: 3.7e-39
DUF496 1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklke 92
+++vle+vr+ r knkl r+ edn++kirdn+krv ll+nl +yi+++ms++++++iie m++dye rvddy+i++ae+s++rre+++k+ke
VIMSS79911 9 FQEVLEYVRMYRLKNKLARDREDNNRKIRDNQKRVLLLDNLNQYIRDDMSIQDVRTIIESMREDYEKRVDDYMIRNAEISQQRREIREKMKE 100
689**************************************************************************************996 PP
Or compare VIMSS79911 to CDD or PaperBLAST