VIMSS79911 has 112 amino acids
Query: DUF496 [M=93]
Accession: PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.6e-41 124.9 17.5 6.7e-41 124.6 17.5 1.1 1 VIMSS79911
Domain annotation for each sequence (and alignments):
>> VIMSS79911
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 124.6 17.5 6.7e-41 6.7e-41 1 92 [. 9 100 .. 9 101 .. 0.98
Alignments for each domain:
== domain 1 score: 124.6 bits; conditional E-value: 6.7e-41
DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklke 92
+++vle+vr++r knkl r+ edn++kirdnqkrv+ll+nl++yi++dmsi+++++iie+m++dye rvddy+i+nae+s++rre+++k+ke
VIMSS79911 9 FQEVLEYVRMYRLKNKLARDREDNNRKIRDNQKRVLLLDNLNQYIRDDMSIQDVRTIIESMREDYEKRVDDYMIRNAEISQQRREIREKMKE 100
689***************************************************************************************96 PP
Or compare VIMSS79911 to CDD or PaperBLAST