VIMSS80960 has 74 amino acids
Query: DUF1414 [M=44]
Accession: PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.4e-24 70.6 2.4 4.4e-24 70.6 2.4 1.4 2 VIMSS80960
Domain annotation for each sequence (and alignments):
>> VIMSS80960
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.4 0.0 0.56 0.56 19 25 .. 15 21 .. 12 23 .. 0.73
2 ! 70.6 2.4 4.4e-24 4.4e-24 1 44 [] 26 69 .. 26 69 .. 0.99
Alignments for each domain:
== domain 1 score: -3.4 bits; conditional E-value: 0.56
DUF1414 19 ilnqsVp 25
iln +++
VIMSS80960 15 ILNDMIA 21
7887776 PP
== domain 2 score: 70.6 bits; conditional E-value: 4.4e-24
DUF1414 1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
H+ApvDLsL vLGN+vTn+l +sV ++qR a+A++F++AL +Sv
VIMSS80960 26 HQAPVDLSLVVLGNMVTNLLVSSVGTNQRIALANAFSEALLNSV 69
9******************************************8 PP
Or compare VIMSS80960 to CDD or PaperBLAST