VIMSS81693 has 67 amino acids
Query: DUF3046 [M=62]
Accession: PF11248.12
Description: Protein of unknown function (DUF3046)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.1e-32 96.7 0.3 4.5e-32 96.6 0.3 1.0 1 VIMSS81693
Domain annotation for each sequence (and alignments):
>> VIMSS81693
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 96.6 0.3 4.5e-32 4.5e-32 1 61 [. 4 64 .. 4 65 .. 0.98
Alignments for each domain:
== domain 1 score: 96.6 bits; conditional E-value: 4.5e-32
DUF3046 1 MRlteFwelveeeFGsayaeslardhvlselggrTaeeAleaGvdprdVWralcdafdvPe 61
+RlteF+e+v FG+ay++s++ dhvl++++grT+++A+e+Gv++rdVWralc +fdvP+
VIMSS81693 4 VRLTEFHERVVLRFGAAYGASVLVDHVLTGFDGRTVAQAIEDGVELRDVWRALCVDFDVPR 64
59**********************************************************8 PP
Or compare VIMSS81693 to CDD or PaperBLAST