PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS818987 to PF04359 (DUF493)

VIMSS818987 has 91 amino acids

Query:       DUF493  [M=84]
Accession:   PF04359.18
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.2e-36  109.2   0.1      7e-36  109.1   0.1    1.0  1  VIMSS818987  


Domain annotation for each sequence (and alignments):
>> VIMSS818987  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.1   0.1     7e-36     7e-36       2      84 .]       9      91 .]       8      91 .] 0.99

  Alignments for each domain:
  == domain 1  score: 109.1 bits;  conditional E-value: 7e-36
       DUF493  2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
                 +l+eFPc+fp+kv+G+ ++efe+av+e+v+ hap+++++++++rpSskg+Y+  tv+v ve++eqld+iyraL++he vk+vL
  VIMSS818987  9 SLIEFPCTFPLKVMGAVHPEFEQAVLETVRLHAPDTQAHHITTRPSSKGNYTGATVQVKVENQEQLDNIYRALTSHELVKVVL 91
                 69*******************************************************************************98 PP



Or compare VIMSS818987 to CDD or PaperBLAST