VIMSS818987 has 91 amino acids
Query: DUF493 [M=84]
Accession: PF04359.18
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.2e-36 109.2 0.1 7e-36 109.1 0.1 1.0 1 VIMSS818987
Domain annotation for each sequence (and alignments):
>> VIMSS818987
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 109.1 0.1 7e-36 7e-36 2 84 .] 9 91 .] 8 91 .] 0.99
Alignments for each domain:
== domain 1 score: 109.1 bits; conditional E-value: 7e-36
DUF493 2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
+l+eFPc+fp+kv+G+ ++efe+av+e+v+ hap+++++++++rpSskg+Y+ tv+v ve++eqld+iyraL++he vk+vL
VIMSS818987 9 SLIEFPCTFPLKVMGAVHPEFEQAVLETVRLHAPDTQAHHITTRPSSKGNYTGATVQVKVENQEQLDNIYRALTSHELVKVVL 91
69*******************************************************************************98 PP
Or compare VIMSS818987 to CDD or PaperBLAST