VIMSS834589 has 500 amino acids
Query: DUF676 [M=217]
Accession: PF05057.18
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-09 23.7 0.0 3.4e-09 22.6 0.0 1.5 1 VIMSS834589
Domain annotation for each sequence (and alignments):
>> VIMSS834589
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 22.6 0.0 3.4e-09 3.4e-09 62 107 .. 143 187 .. 105 208 .. 0.77
Alignments for each domain:
== domain 1 score: 22.6 bits; conditional E-value: 3.4e-09
DUF676 62 laeevlevvkkkkdkikkiSfvghSlGgliaryaigklkekkmtlk 107
l+e + +v k k+k k+i fvghSlGg a++a+ + k++ k
VIMSS834589 143 LLEFLEQVNKIIKNKHKRIIFVGHSLGGYLAQMALIYCDIKYKD-K 187
555555666666667999*******************9988763.3 PP
Or compare VIMSS834589 to CDD or PaperBLAST