VIMSS845520 has 358 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.8e-27 79.8 2.3 1.9e-26 78.6 2.3 1.7 1 VIMSS845520
Domain annotation for each sequence (and alignments):
>> VIMSS845520
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.6 2.3 1.9e-26 1.9e-26 1 78 [. 7 84 .. 7 85 .. 0.99
Alignments for each domain:
== domain 1 score: 78.6 bits; conditional E-value: 1.9e-26
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
Rk+Ide+D+el++L+a+R+e++++i+++K+e++ pv d +Re evl+r+++ a++lgldp+ +e++++ei+ s+++Q
VIMSS845520 7 RKQIDELDAELVKLMAKRLEVSDQIGKVKEETNSPVQDLSRESEVLNRVQSLARSLGLDPQDIESLYQEILFISKKQQ 84
9***************************************************************************99 PP
Or compare VIMSS845520 to CDD or PaperBLAST