VIMSS846307 has 221 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.16
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.1e-21 61.1 1.0 3.1e-21 61.1 1.0 3.1 3 VIMSS846307
Domain annotation for each sequence (and alignments):
>> VIMSS846307
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.1 1.0 3.1e-21 3.1e-21 2 49 .] 14 61 .. 13 61 .. 0.97
2 ? -3.3 0.4 0.41 0.41 3 11 .. 120 128 .. 118 133 .. 0.51
3 ? 0.9 0.2 0.02 0.02 6 17 .. 197 208 .. 192 215 .. 0.57
Alignments for each domain:
== domain 1 score: 61.1 bits; conditional E-value: 3.1e-21
DUF1648 2 lilltlvlglilypkLPdqiPtHfnasGepDgygsKafglfllPllll 49
+il+++v gli +p+ Pd P+H++++G +D+yg K++gl+l+Pl++l
VIMSS846307 14 IILAMFVTGLITWPNAPDLLPVHWGIDGRVDRYGGKFEGLLLMPLICL 61
89*******************************************986 PP
== domain 2 score: -3.3 bits; conditional E-value: 0.41
DUF1648 3 illtlvlgl 11
il+++ l l
VIMSS846307 120 ILIMVGLLL 128
444444444 PP
== domain 3 score: 0.9 bits; conditional E-value: 0.02
DUF1648 6 tlvlglilypkL 17
++gl++y+ L
VIMSS846307 197 LGIIGLFVYSYL 208
555555555544 PP
Or compare VIMSS846307 to CDD or PaperBLAST