VIMSS846307 has 221 amino acids
Query: DUF1648 [M=49] Accession: PF07853.15 Description: Domain of unknown function (DUF1648) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-21 62.3 1.0 1.4e-21 62.3 1.0 3.1 3 VIMSS846307 Domain annotation for each sequence (and alignments): >> VIMSS846307 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.3 1.0 1.4e-21 1.4e-21 2 49 .] 14 61 .. 13 61 .. 0.97 2 ? -2.8 0.5 0.28 0.28 2 14 .. 119 131 .. 118 134 .. 0.60 3 ? 1.2 0.2 0.017 0.017 4 17 .. 195 208 .. 192 215 .. 0.60 Alignments for each domain: == domain 1 score: 62.3 bits; conditional E-value: 1.4e-21 DUF1648 2 lillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49 +il+++v gli +p+ Pd +P+H++++G +D+yg K+ gl+l+Pl++l VIMSS846307 14 IILAMFVTGLITWPNAPDLLPVHWGIDGRVDRYGGKFEGLLLMPLICL 61 99********************************************86 PP == domain 2 score: -2.8 bits; conditional E-value: 0.28 DUF1648 2 lillplvlglily 14 +il+++ l l+l VIMSS846307 119 FILIMVGLLLALL 131 4666666666655 PP == domain 3 score: 1.2 bits; conditional E-value: 0.017 DUF1648 4 llplvlglilypkL 17 ll ++gl++y+ L VIMSS846307 195 LLLGIIGLFVYSYL 208 55556666666544 PP
Or compare VIMSS846307 to CDD or PaperBLAST