VIMSS8503889 has 107 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-23 68.5 0.3 3.3e-23 68.2 0.3 1.1 1 VIMSS8503889
Domain annotation for each sequence (and alignments):
>> VIMSS8503889
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 68.2 0.3 3.3e-23 3.3e-23 1 78 [. 14 90 .. 14 91 .. 0.97
Alignments for each domain:
== domain 1 score: 68.2 bits; conditional E-value: 3.3e-23
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+eId++D+e+++Ll +R++++ ++ ++Kk n+ ++ p+R++ +l ++r++a+elg++++++e++f++i ++ +a Q
VIMSS8503889 14 RREIDSLDKEIVNLLGRRLDYVLAASRFKK-NEEDIPAPDRVKSMLVERRAWARELGISEDFIENLFKQITAWYIATQ 90
99***************************6.666***************************************99988 PP
Or compare VIMSS8503889 to CDD or PaperBLAST