VIMSS870681 has 77 amino acids
Query: DUF1161 [M=52] Accession: PF06649.17 Description: Protein of unknown function (DUF1161) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-29 87.9 1.1 7.5e-29 86.2 1.3 1.6 2 VIMSS870681 Domain annotation for each sequence (and alignments): >> VIMSS870681 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.12 0.12 19 31 .. 3 15 .. 1 19 [. 0.76 2 ! 86.2 1.3 7.5e-29 7.5e-29 1 51 [. 24 73 .. 24 74 .. 0.98 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.12 DUF1161 19 sytLeiVdkdeaa 31 + L +V+ + a+ VIMSS870681 3 RFALAVVSCALAT 15 7999999988775 PP == domain 2 score: 86.2 bits; conditional E-value: 7.5e-29 DUF1161 1 CeelkaeIdaKiqanGVtsytLeiVdkdeaakasgkVVGsCengtkkIvYq 51 CeelkaeI+aKiqa+GV sytLeiV +de+ +++++VVGsCengt+kI+Yq VIMSS870681 24 CEELKAEIEAKIQAQGVPSYTLEIVTNDEV-HDNNMVVGSCENGTRKIIYQ 73 *****************************9.6******************9 PP
Or compare VIMSS870681 to CDD or PaperBLAST