VIMSS884838 has 164 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-50 153.5 0.1 9.6e-50 153.2 0.1 1.1 1 VIMSS884838
Domain annotation for each sequence (and alignments):
>> VIMSS884838
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 153.2 0.1 9.6e-50 9.6e-50 1 107 [] 55 161 .. 55 161 .. 0.99
Alignments for each domain:
== domain 1 score: 153.2 bits; conditional E-value: 9.6e-50
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYqa 98
gv+l+sde++ee+ +d+d++++ial+fp+FtDGR +S arlLR+r+gykgelrA+GdvlrDql++++rcGfdaf++r+dkd+ +a + l++fsv+Yqa
VIMSS884838 55 GVWLDSDEEAEEIGEDVDQFQVIALNFPAFTDGRSFSNARLLRDRYGYKGELRAIGDVLRDQLFYMQRCGFDAFAVRADKDPYEALEGLKDFSVTYQA 152
8************************************************************************************************* PP
DUF934 99 avdeeqplf 107
a+de+ plf
VIMSS884838 153 ATDEPLPLF 161
*******97 PP
Or compare VIMSS884838 to CDD or PaperBLAST