PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS884838 to PF06073 (DUF934)

VIMSS884838 has 164 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.17
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-50  155.4   0.1    2.4e-50  155.1   0.1    1.1  1  VIMSS884838  


Domain annotation for each sequence (and alignments):
>> VIMSS884838  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  155.1   0.1   2.4e-50   2.4e-50       1     107 []      55     161 ..      55     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 155.1 bits;  conditional E-value: 2.4e-50
       DUF934   1 gvalesdedveelaadldrlalvalefpkFtDGRgySlarlLRerlgykgelrAvGdvlrDqlallkrcGfdafelradkdleaaekalerfseaYqa 98 
                  gv+l+sde++ee+ +d+d+++++al+fp+FtDGR +S arlLR+r+gykgelrA+GdvlrDql++++rcGfdaf++radkd+ +a++ l++fs++Yqa
  VIMSS884838  55 GVWLDSDEEAEEIGEDVDQFQVIALNFPAFTDGRSFSNARLLRDRYGYKGELRAIGDVLRDQLFYMQRCGFDAFAVRADKDPYEALEGLKDFSVTYQA 152
                  8************************************************************************************************* PP

       DUF934  99 avdepeplf 107
                  a+dep plf
  VIMSS884838 153 ATDEPLPLF 161
                  *******98 PP



Or compare VIMSS884838 to CDD or PaperBLAST