VIMSS901710 has 85 amino acids
Query: DUF1488 [M=82]
Accession: PF07369.15
Description: Protein of unknown function (DUF1488)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8e-33 98.7 0.1 8.8e-33 98.6 0.1 1.0 1 VIMSS901710
Domain annotation for each sequence (and alignments):
>> VIMSS901710
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.6 0.1 8.8e-33 8.8e-33 1 82 [] 5 84 .. 5 84 .. 0.99
Alignments for each domain:
== domain 1 score: 98.6 bits; conditional E-value: 8.8e-33
DUF1488 1 IlFpdresydaerqaVrFpaqvdgreveCavsaeaLedhfgaesldeedllaaFdahRfdieeaaerlieaegfdedgtilL 82
I+Fpdre++d +++ ++Fpa+v+g++++Ca+++++L+ +fg+e+ +e++la F+++R+d+ee+ae+li a+++d++g+i+L
VIMSS901710 5 IQFPDREEWDTAASVIIFPALVNGMQLTCAIKKDVLAYRFGGET--AEQWLAIFREYRWDLEEEAEALILAQQEDDHGWIWL 84
9******************************************8..8*********************************98 PP
Or compare VIMSS901710 to CDD or PaperBLAST