VIMSS912105 has 55 amino acids
Query: VraX [M=55] Accession: PF17412.6 Description: Family of unknown function Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-44 135.5 1.3 2.1e-44 135.4 1.3 1.0 1 VIMSS912105 Domain annotation for each sequence (and alignments): >> VIMSS912105 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 135.4 1.3 2.1e-44 2.1e-44 1 55 [] 1 55 [] 1 55 [] 0.99 Alignments for each domain: == domain 1 score: 135.4 bits; conditional E-value: 2.1e-44 VraX 1 miiYRryieeGaPvYeiitktFktvsikCDesFsdteiykLLsLLedDvDnmkvs 55 miiYR+y++eGaPvYeiitktF++vsikCD+sFsdtei+kLLsLL+dD+D+mkvs VIMSS912105 1 MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS 55 9*****************************************************8 PP
Or compare VIMSS912105 to CDD or PaperBLAST